Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0576700_circ_g.7 |
ID in PlantcircBase | osa_circ_020519 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 21088105-21088235 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0576700 |
Parent gene annotation |
Similar to 60S ribosomal protein L13 (BBC1 protein homolog). (Os 03t0576700-01) |
Parent gene strand | - |
Alternative splicing | Os03g0576700_circ_g.2 Os03g0576700_circ_g.3 Os03g0576700_circ_g.4 Os03g0576700_circ_g.5 Os03g0576700_circ_g.6 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0576700-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.599246565 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
21088215-21088209(-) 21088187-21088234(-) |
Potential amino acid sequence |
MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIGKKERRRKW*(-) MATSRSTGRTMSRHGSTSPPASRGAALVRRRGGENGEAQQRYPQWPLQEALAELCQDMVQPARP QAEAPHW*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |