Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA008297_circ_g.1 |
ID in PlantcircBase | osi_circ_003960 |
Alias | 2:19679778|19680645 |
Organism | Oryza sativa ssp. indica |
Position | chr2: 19679778-19680645 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA008297 |
Parent gene annotation | NA |
Parent gene strand | + |
Alternative splicing | BGIOSGA006382_circ_igg.1 BGIOSGA008282_circ_ig.1 BGIOSGA008282_circ_ig.2 BGIOSGA008287_circ_g.1 BGIOSGA008288_circ_g.1 BGIOSGA008289_circ_g.1 BGIOSGA008289_circ_g.2 BGIOSGA008296_circ_igg.1 BGIOSGA008290_circ_ig.1 BGIOSGA008296_circ_igg.2 BGIOSGA006402_circ_g.1 BGIOSGA008298_circ_g.1 BGIOSGA006383_circ_ig.1 BGIOSGA006382_circ_g.1 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | BGIOSGA008297-TA:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
19679943-19679780(+) |
Potential amino acid sequence |
MMISYMIDGQGYLIINRECVGEDIEDLEYTPKPEFEGHFKVKNVANET*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |