Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | BGIOSGA008297_circ_g.1 |
| ID in PlantcircBase | osi_circ_003960 |
| Alias | 2:19679778|19680645 |
| Organism | Oryza sativa ssp. indica |
| Position | chr2: 19679778-19680645 JBrowse» |
| Reference genome | Oryza_indica.ASM465v1.42 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | BGIOSGA008297 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | BGIOSGA006382_circ_igg.1 BGIOSGA008282_circ_ig.1 BGIOSGA008282_circ_ig.2 BGIOSGA008287_circ_g.1 BGIOSGA008288_circ_g.1 BGIOSGA008289_circ_g.1 BGIOSGA008289_circ_g.2 BGIOSGA008296_circ_igg.1 BGIOSGA008290_circ_ig.1 BGIOSGA008296_circ_igg.2 BGIOSGA006402_circ_g.1 BGIOSGA008298_circ_g.1 BGIOSGA006383_circ_ig.1 BGIOSGA006382_circ_g.1 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | BGIOSGA008297-TA:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19679943-19679780(+) |
| Potential amino acid sequence |
MMISYMIDGQGYLIINRECVGEDIEDLEYTPKPEFEGHFKVKNVANET*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Huang et al., 2021 |