Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA037874_circ_g.8 |
ID in PlantcircBase | osi_circ_003555 |
Alias | 12:22979729|22980396 |
Organism | Oryza sativa ssp. indica |
Position | chr12: 22979729-22980396 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA037874 |
Parent gene annotation | NA |
Parent gene strand | + |
Alternative splicing | BGIOSGA037874_circ_g.1 BGIOSGA037874_circ_g.2 BGIOSGA037874_circ_igg.1 BGIOSGA037874_circ_g.2 BGIOSGA037874_circ_g.3 BGIOSGA037874_circ_g.4 BGIOSGA037874_circ_g.5 BGIOSGA037874_circ_g.6 BGIOSGA037874_circ_g.7 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | BGIOSGA037874-TA:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
22979733-22979735(+) |
Potential amino acid sequence |
MVKNGEFIYKFDPTKKARFGILQRYEKDDTNIRWFELPNCFIFHNANAWEEGDEVILITCRLEN PDLDKVNGYQSDNLENFGNELYEMRFNMKTGAASQKQLSVSAVDFPRINESCTGRKW*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |