Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0261200_circ_g.6 |
| ID in PlantcircBase | osa_circ_001214 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 8795341-8796172 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0261200 |
| Parent gene annotation |
No apical meristem (NAM) protein domain containing protein. (Os0 1t0261200-01);Similar to NAC domain-containing protein 74. (Os01 t0261200-02) |
| Parent gene strand | - |
| Alternative splicing | Os01g0261200_circ_g.2 Os01g0261200_circ_g.3 Os01g0261200_circ_g.4 Os01g0261200_circ_g.5 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0261200-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.171892368 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8796097-8795359(+) 8796165-8796169(-) |
| Potential amino acid sequence |
MSSVSFGWNPNPGGRTMSRKDSMVQIFISGQA*(+) MESLRDMVLPPGFGFHPKDTELISHYLKKKIHGQKIEYEIIPEVDIYKHEPWDLPAKCDVPTQD NKWHFFAARDRKYPNGSRSNRATVAGYWKSTGKDRAIKMGKQTIGTKKTLVFHEGRPPTGRRTE WIMHEYYIDERECQACPDMKI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |