Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0261200_circ_g.2 |
ID in PlantcircBase | osa_circ_001211 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 8794537-8794890 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os01g0261200 |
Parent gene annotation |
No apical meristem (NAM) protein domain containing protein. (Os0 1t0261200-01);Similar to NAC domain-containing protein 74. (Os01 t0261200-02) |
Parent gene strand | - |
Alternative splicing | Os01g0261200_circ_g.3 Os01g0261200_circ_g.4 Os01g0261200_circ_g.5 Os01g0261200_circ_g.6 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0261200-02:1 Os01t0261200-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.108286064 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8794808-8794539(+) 8794885-8794640(+) 8794624-8794760(-) |
Potential amino acid sequence |
MRITVVQLIAIPWDPVISFGNTTKYICIR*(+) MHPMIQHFVHLETDQQKPDSVQGQRKDQIVHSTNHPD*(+) MNYLILSLTLNRVWLLLICLQMNKMLNHRMHMYFVVLPKEMTGSQGMAMSWTTVILIQNHMMLL HQLSVLNS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |