Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0160600_circ_g.2 |
| ID in PlantcircBase | osa_circ_026731 |
| Alias | Os_ciR3082 |
| Organism | Oryza sativa |
| Position | chr5: 3563210-3563694 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os05g0160600 |
| Parent gene annotation |
Peptidase cysteine/serine, trypsin-like domain containing protei n. (Os05t0160600-01) |
| Parent gene strand | - |
| Alternative splicing | Os05g0160600_circ_g.1 Os05g0160600_circ_g.3 |
| Support reads | 4/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0160600-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_015935 osi_circ_015934 |
| PMCS | 0.219312715 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3563684-3563629(+) 3563294-3563465(-) 3563266-3563677(-) |
| Potential amino acid sequence |
MYEQLNLLHMSMHVCRIEIERTSGFGKRPNVIPATSPRSSIAGPPVPHSSIAELRDNQYLYFKK NGGSCNRTVPDLAKKDDFLSLAKVNTFCPNFGLEPKLAGSNGKSTKASNNAIR*(+) MTFGRLPNPDVLSISILQTCIDMWRRFSCSYICLIGLPQKDNCFSSMHTTVLHCWRPWWTFHWS LLILALVQNLDKRCLPWQGTRSHPSLLGLGQSCCRIHHFF*(-) MSSLSLSCRHALTCGGDSVARTFA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |