Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0160600_circ_g.2 |
ID in PlantcircBase | osa_circ_026731 |
Alias | Os_ciR3082 |
Organism | Oryza sativa |
Position | chr5: 3563210-3563694 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os05g0160600 |
Parent gene annotation |
Peptidase cysteine/serine, trypsin-like domain containing protei n. (Os05t0160600-01) |
Parent gene strand | - |
Alternative splicing | Os05g0160600_circ_g.1 Os05g0160600_circ_g.3 |
Support reads | 4/2 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os05t0160600-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_015935 osi_circ_015934 |
PMCS | 0.219312715 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3563684-3563629(+) 3563294-3563465(-) 3563266-3563677(-) |
Potential amino acid sequence |
MYEQLNLLHMSMHVCRIEIERTSGFGKRPNVIPATSPRSSIAGPPVPHSSIAELRDNQYLYFKK NGGSCNRTVPDLAKKDDFLSLAKVNTFCPNFGLEPKLAGSNGKSTKASNNAIR*(+) MTFGRLPNPDVLSISILQTCIDMWRRFSCSYICLIGLPQKDNCFSSMHTTVLHCWRPWWTFHWS LLILALVQNLDKRCLPWQGTRSHPSLLGLGQSCCRIHHFF*(-) MSSLSLSCRHALTCGGDSVARTFA*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |