Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0398800_circ_g.6 |
| ID in PlantcircBase | osa_circ_023682 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 19700706-19705339 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0398800 |
| Parent gene annotation |
Similar to H0209H04.5 protein. (Os04t0398800-01) |
| Parent gene strand | - |
| Alternative splicing | Os04g0398800_circ_g.7 Os04g0398800_circ_g.8 Os04g0398800_circ_g.9 Os04g0398800_circ_g.10 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0398800-01:8 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_014316 |
| PMCS | 0.099506256 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19700733-19701473(-) |
| Potential amino acid sequence |
MFIEAMMGCPDLQYVSTYYASKYAAKIFAVLDIIPAILLKISIDVDYINAEQSTHLINRINKET LEDLMQLDQQLCQAQQAAKLCIVSEGLLNMSKNFDGLIDLNLGGWLKQMIKKELVSQLQGKLKA LSLLIYGDIEGNLMSLSNYMLSQMQRMEFLQHILHIDGCSIWEETLTAVLEECAKREVLEFMGC MQPSTNMVKPSNHMSNPGTFFGNILD*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |