Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0398800_circ_g.6 |
ID in PlantcircBase | osa_circ_023682 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 19700706-19705339 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os04g0398800 |
Parent gene annotation |
Similar to H0209H04.5 protein. (Os04t0398800-01) |
Parent gene strand | - |
Alternative splicing | Os04g0398800_circ_g.7 Os04g0398800_circ_g.8 Os04g0398800_circ_g.9 Os04g0398800_circ_g.10 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os04t0398800-01:8 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_014316 |
PMCS | 0.099506256 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
19700733-19701473(-) |
Potential amino acid sequence |
MFIEAMMGCPDLQYVSTYYASKYAAKIFAVLDIIPAILLKISIDVDYINAEQSTHLINRINKET LEDLMQLDQQLCQAQQAAKLCIVSEGLLNMSKNFDGLIDLNLGGWLKQMIKKELVSQLQGKLKA LSLLIYGDIEGNLMSLSNYMLSQMQRMEFLQHILHIDGCSIWEETLTAVLEECAKREVLEFMGC MQPSTNMVKPSNHMSNPGTFFGNILD*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |