Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0665500_circ_g.9 |
| ID in PlantcircBase | osa_circ_031897 |
| Alias | Os_ciR10551 |
| Organism | Oryza sativa |
| Position | chr6: 27497960-27499264 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os06g0665500 |
| Parent gene annotation |
Peptidase M20 domain containing protein. (Os06t0665500-01) |
| Parent gene strand | - |
| Alternative splicing | Os06g0665500_circ_g.1 Os06g0665500_circ_g.2 Os06g0665500_circ_g.3 Os06g0665500_circ_g.4 Os06g0665500_circ_g.5 Os06g0665500_circ_g.6 Os06g0665500_circ_g.7 Os06g0665500_circ_g.8 Os06g0665500_circ_g.10 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0665500-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.25452712 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
27498369-27498411(-) |
| Potential amino acid sequence |
MKDAGLTTWIDQMGNIHGRFEPTNSTKEALLIGSHMDTVIDAGMYDGALGIISAISALKVLKVT GRLQRLTRPVEMDWSWEEMGSTGRSSGMRRCSGSKNLARYLMGKVTLRGHF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |