Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G59870_circ_g.15 |
| ID in PlantcircBase | ath_circ_008072 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 22037573-22037677 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | AT1G59870 |
| Parent gene annotation |
ABC transporter G family member 36 |
| Parent gene strand | + |
| Alternative splicing | AT1G59870_circ_g.10 AT1G59870_circ_g.11 AT1G59870_circ_g.12 AT1G59870_circ_g.13 AT1G59870_circ_g.14 AT1G59870_circ_g.16 AT1G59870_circ_g.17 AT1G59870_circ_g.18 AT1G59870_circ_g.19 AT1G59870_circ_g.20 |
| Support reads | 1 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT1G59870.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.239948203 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22037612-22037674(+) 22037641-22037674(+) |
| Potential amino acid sequence |
MKTLIRGKIQCVDLCLLQMGTELLGRRQVYFQKKKMKTLIRGKIQCVDLCLLQMGTELLGRRQV YFQKKKMKTLIRGKIQCVDLCLLQMGTELLGRRQVYFQKKKMKTLIRGKIQCVDLCLLQMGTE( +) MRRSLSTADGNRTLGKKAGLLPEEENEDADQGKDPMRRSLSTADGNRTLGKKAGLLPEEENEDA DQGKDPMRRSLSTADGNRTLGKKAGLLPEEENEDADQGKDPMRRSLSTADGNR(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |