Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G17840_circ_g.4 |
ID in PlantcircBase | ath_circ_003169 |
Alias | AT1G17840_C2, AT1G17840_C2 |
Organism | Arabidpsis thaliana |
Position | chr1: 6144533-6144727 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | AT1G17840 |
Parent gene annotation |
ABC transporter G family member 11 |
Parent gene strand | + |
Alternative splicing | AT1G17840_circ_g.2 AT1G17840_circ_g.3 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT1G17840.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.668599638 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
6144618-6144724(+) |
Potential amino acid sequence |
MSRDFGYYWLRLLIYILVTVCIGTIYLNVGTSYSAILKGTILDSGGSQASFLLQTYTLTKRSFI NMSRDFGYYWLRLLIYILVTVCIGTIYLNVGTSYSAILKGTILDSGGSQASFLLQTYTLTKRSF INMSRDFGYYWLRLLIYILVTVCIGTIYLNVGTSYSAILKGTILDSGGSQASFLLQTYTLTKRS FINMSRDFGYYWLRLLIYILVTVCIGTIYLNVGTSYSAIL |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Zhang et al., 2019 |