Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G04720_circ_g.8 |
| ID in PlantcircBase | ath_circ_029686 |
| Alias | AT4G04720_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr4: 2396097-2396474 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | MapSplice, CIRI2 |
| Parent gene | AT4G04720 |
| Parent gene annotation |
Calcium-dependent protein kinase 21 |
| Parent gene strand | - |
| Alternative splicing | 4_circ_ag.3 4_circ_ag.4 4_circ_ag.5 4_circ_ag.6 4_circ_ag.7 AT4G04700_circ_g.1 4_circ_igg.2 4_circ_igg.3 4_circ_igg.4 AT4G04720_circ_g.1 AT4G04720_circ_g.2 AT4G04720_circ_g.3 4_circ_ag.4 AT4G04720_circ_g.5 AT4G04720_circ_g.6 AT4G04720_circ_g.7 4_circ_ag.9 4_circ_ag.10 AT4G04720_circ_g.11 4_circ_ag.12 AT4G04740_circ_g.1 AT4G04740_circ_g.2 AT4G04740_circ_g.3 AT4G04740_circ_g.4 AT4G04740_circ_g.5 AT4G04740_circ_g.6 AT4G04740_circ_g.7 AT4G04740_circ_g.8 AT4G04740_circ_g.9 |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT4G04720.2:2 AT4G04720.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.509845671 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2396146-2396099(-) |
| Potential amino acid sequence |
MLTKDPKRRITAAQVLGKVYRDIVGSAYYVAPEVLRRSYGKEIDIWSAGVILYILLSGVPPFWA ENEKGIFDEVIKGEIDFVSEPWPSISESAKDLVRKMLTKDPKRRITAAQVLGKVYRDIVGSAYY VAPEVLRRSYGKEIDIWSAGVILYILLSGVPPFWAENEKGIFDEVIKGEIDFVSEPWPSISESA KDLVRKMLTKDPKRRITAAQVLGKVYRDIVGSAYYVAPEVLRRSYGKEIDIWSAGVILYILLSG VPPFWAENEKGIFDEVIKGEIDFVSEPWPSISESAKDLVRKMLTKDPKRRITAAQVL(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Liu et al., 2017;Zhang et al., 2019 |