Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT4G04720_circ_g.7 |
ID in PlantcircBase | ath_circ_029685 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr4: 2396097-2396249 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | AT4G04720 |
Parent gene annotation |
Calcium-dependent protein kinase 21 |
Parent gene strand | - |
Alternative splicing | 4_circ_ag.3 4_circ_ag.4 4_circ_ag.5 4_circ_ag.6 4_circ_ag.7 AT4G04700_circ_g.1 4_circ_igg.2 4_circ_igg.3 4_circ_igg.4 AT4G04720_circ_g.1 AT4G04720_circ_g.2 AT4G04720_circ_g.3 4_circ_ag.4 AT4G04720_circ_g.5 AT4G04720_circ_g.6 AT4G04720_circ_g.8 4_circ_ag.9 4_circ_ag.10 AT4G04720_circ_g.11 4_circ_ag.12 AT4G04740_circ_g.1 AT4G04740_circ_g.2 AT4G04740_circ_g.3 AT4G04740_circ_g.4 AT4G04740_circ_g.5 AT4G04740_circ_g.6 AT4G04740_circ_g.7 AT4G04740_circ_g.8 AT4G04740_circ_g.9 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT4G04720.1:1 AT4G04720.2:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.346053335 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2396146-2396099(-) 2396219-2396246(+) |
Potential amino acid sequence |
MLTKDPKRRITAAQVLENEKGIFDEVIKGEIDFVSEPWPSISESAKDLVRKMLTKDPKRRITAA QVLENEKGIFDEVIKGEIDFVSEPWPSISESAKDLVRKMLTKDPKRRITAAQVLENEKGIFDEV IKGEIDFVSEPWPSISESAKDLVRKMLTKDPKRRITAAQVL(-) MTSSNIPFSFSRTCAAVIRLFGSLVSIFLTRSFALSDIEGHGSLTKSISPFMTSSNIPFSFSRT CAAVIRLFGSLVSIFLTRSFALSDIEGHGSLTKSISPFMTSSNIPFSFSRTCAAVIRLFGSLVS IFLTRSFALSDIEGHGSLTKSISPFMTSSNIPFSF(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |