Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0716700_circ_g.22 |
| ID in PlantcircBase | osa_circ_032371 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr6: 30447875-30449590 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os06g0716700 |
| Parent gene annotation |
Similar to Heat shock protein 90. (Os06t0716700-01);Similar to H eat shock protein 90. (Os06t0716700-02);Similar to Heat shock pr otein 90. (Os06t0716700-03) |
| Parent gene strand | - |
| Alternative splicing | Os06g0716700_circ_g.12 Os06g0716700_circ_g.13 Os06g0716700_circ_g.14 Os06g0716700_circ_g.15 Os06g0716700_circ_g.16 Os06g0716700_circ_g.17 Os06g0716700_circ_g.18 Os06g0716700_circ_g.19 Os06g0716700_circ_g.20 Os06g0716700_circ_g.21 Os06g0716700_circ_g.23 Os06g0716700_circ_g.24 Os06g0716700_circ_g.25 Os06g0716700_circ_g.26 Os06g0716700_circ_g.27 Os06g0716700_circ_g.28 Os06g0716700_circ_g.29 |
| Support reads | 3 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0716700-03:2 Os06t0716700-02:6 Os06t0716700-01:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.165378341 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30449307-30449548(-) |
| Potential amino acid sequence |
MDIIINSLYSNKDIFLRELISNASDALDKIRFLALTDKEVLGEGDTAKLEIQIKLDKEKKILSI RDRGIGMTKEDLIKNLGTIAKSGTSAFVEKMQTGGDLNLIGQFGVGFYSVYLVADYVEVISKHN DDKQHVWESKADGSFAISEDTWNEPLGRGTEIRLHLRDEAKEYVEEDKLKLRSSKSMLMTALMS *(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |