Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d002663_circ_g.4 |
ID in PlantcircBase | zma_circ_007085 |
Alias | Zm02circ00021, zma_circ_0000668, GRMZM2G082181_C1 |
Organism | Zea mays |
Position | chr2: 18763108-18763460 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2, find_circ |
Parent gene | Zm00001d002663 |
Parent gene annotation |
Protein LAZ1 |
Parent gene strand | + |
Alternative splicing | Zm00001d002663_circ_g.1 Zm00001d002663_circ_g.2 Zm00001d002663_circ_g.3 |
Support reads | NA |
Tissues | leaf, endosperm, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d002663_T007:1 Zm00001d002663_T003:1 Zm00001d002663_T008:2 Zm00001d002663_T006:2 Zm00001d002663_T002:2 Zm00001d002663_T001:2 Zm00001d002663_T009:2 Zm00001d002663_T004:2 Zm00001d002663_T010:1 Zm00001d002663_T005:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.249886632 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
18763437-18763117(+) |
Potential amino acid sequence |
MENSIYDVGGEDKTIAFLKREGGSGSGQSLLHHTSEKGIIHHHFPVNYVLKPWRLGTRFYLIIK FGIFQYVIIKTLTATLSLLLESFGVYCDGEFNLRCGWGR*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |