Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0261900_circ_g.1 |
ID in PlantcircBase | osa_circ_018970 |
Alias | Os_ciR9197 |
Organism | Oryza sativa |
Position | chr3: 8549887-8550689 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | find_circ |
Parent gene | Os03g0261900 |
Parent gene annotation |
Similar to HEAT repeat family protein, expressed. (Os03t0261900- 01);Armadillo-like helical domain containing protein. (Os03t0261 900-02) |
Parent gene strand | - |
Alternative splicing | Os03g0261900_circ_g.2 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0261900-01:3 Os03t0261900-02:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_014160 |
PMCS | 0.2345445 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8550675-8549963(+) 8550683-8550649(-) |
Potential amino acid sequence |
MFITVFQCCSTPILAHLTNTESSISPVCRLR*(+) MNIYIKTMREDDDKEVVAQACTSLADIVRDCGFAIIEPYITRLADATLILLRQESCCQQVESDG EDDGDIDHDEVLMDAVSDLLPAFAKVMGSYFDPIFTKLFDSLMKFAKSPHPPQDKTMVVATLAE VAQGMGAPISAYVDKIMPLVLKELASSEATNRRNAAFCVGEMCKNGGAAALKYSNEHLYQDHER G*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |