Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0261900_circ_g.2 |
| ID in PlantcircBase | osa_circ_018971 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 8550081-8550689 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0261900 |
| Parent gene annotation |
Similar to HEAT repeat family protein, expressed. (Os03t0261900- 01);Armadillo-like helical domain containing protein. (Os03t0261 900-02) |
| Parent gene strand | - |
| Alternative splicing | Os03g0261900_circ_g.1 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0261900-02:3 Os03t0261900-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.249890627 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8550675-8550145(+) 8550683-8550683(-) |
| Potential amino acid sequence |
MFITVYQHKQRLELPFPERPQLKWQQP*(+) MNIYIKTMREDDDKEVVAQACTSLADIVRDCGFAIIEPYITRLADATLILLRQESCCQQVESDG EDDGDIDHDEVLMDAVSDLLPAFAKVMGSYFDPIFTKLFDSLMKFAKSPHPPQDKTMVVATLAE VAQGMGAPISAYVDIQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |