Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G21540_circ_g.1 |
| ID in PlantcircBase | ath_circ_032001 |
| Alias | AT4G21540_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr4: 11460245-11460715 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, circRNA_finder, CIRI2 |
| Parent gene | AT4G21540 |
| Parent gene annotation |
SPHK1 |
| Parent gene strand | + |
| Alternative splicing | AT4G21534_circ_g.1 4_circ_ag.2 4_circ_ag.3 4_circ_ag.4 4_circ_ag.5 AT4G21540_circ_g.2 AT4G21540_circ_g.3 AT4G21540_circ_g.4 |
| Support reads | 2 |
| Tissues | root, leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT4G21540.2:2 AT4G21540.3:2 AT4G21540.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.268246631 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11460286-11460712(+) |
| Potential amino acid sequence |
MDVSKYDGIVCVSGDGILVEVVNGLLEREDWKTAIKLPIGMVPAETKYQLHAKEIVRSMDVSKY DGIVCVSGDGILVEVVNGLLEREDWKTAIKLPIGMVPAETKYQLHAKEIVRSMDVSKYDGIVCV SGDGILVEVVNGLLEREDWKTAIKLPIGMVPAETKYQLHAKEIVRSMDVSKYDGIVCVSGDGIL VEVVNGLLEREDWKTAIKLPIGMVPA(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Zhang et al., 2019 |