Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT4G21540_circ_g.1 |
ID in PlantcircBase | ath_circ_032001 |
Alias | AT4G21540_C1 |
Organism | Arabidpsis thaliana |
Position | chr4: 11460245-11460715 JBrowse» |
Reference genome | TAIR10.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, circRNA_finder, CIRI2 |
Parent gene | AT4G21540 |
Parent gene annotation |
SPHK1 |
Parent gene strand | + |
Alternative splicing | AT4G21534_circ_g.1 4_circ_ag.2 4_circ_ag.3 4_circ_ag.4 4_circ_ag.5 AT4G21540_circ_g.2 AT4G21540_circ_g.3 AT4G21540_circ_g.4 |
Support reads | 2 |
Tissues | root, leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT4G21540.2:2 AT4G21540.3:2 AT4G21540.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.268246631 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
11460286-11460712(+) |
Potential amino acid sequence |
MDVSKYDGIVCVSGDGILVEVVNGLLEREDWKTAIKLPIGMVPAETKYQLHAKEIVRSMDVSKY DGIVCVSGDGILVEVVNGLLEREDWKTAIKLPIGMVPAETKYQLHAKEIVRSMDVSKYDGIVCV SGDGILVEVVNGLLEREDWKTAIKLPIGMVPAETKYQLHAKEIVRSMDVSKYDGIVCVSGDGIL VEVVNGLLEREDWKTAIKLPIGMVPA(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Chu et al., 2017;Zhang et al., 2019 |