Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT4G21540_circ_g.3 |
ID in PlantcircBase | ath_circ_032003 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr4: 11460643-11460715 JBrowse» |
Reference genome | TAIR10.38 |
Type | ue-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT4G21540 |
Parent gene annotation |
SPHK1 |
Parent gene strand | + |
Alternative splicing | AT4G21534_circ_g.1 4_circ_ag.2 4_circ_ag.3 4_circ_ag.4 4_circ_ag.5 AT4G21540_circ_g.1 AT4G21540_circ_g.2 AT4G21540_circ_g.4 |
Support reads | 1 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT4G21540.3:1 AT4G21540.1:1 AT4G21540.2:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.149540183 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
11460687-11460645(-) |
Potential amino acid sequence |
MAVFQSSLSSSPFTTCRDHSDRQFYGSLPVFSFKQSIYNLQGPFRSAILWQSSSLLFQAVHLQP AGTIPIGNFMAVFQSSLSSSPFT(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |