Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0584600_circ_g.3 |
| ID in PlantcircBase | osa_circ_024999 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 29532865-29533510 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0584600 |
| Parent gene annotation |
Similar to Calcium dependent protein kinase. (Os04t0584600-01);S imilar to Calcium-dependent protein kinase. (Os04t0584600-02);Si milar to cDNA clone:001-041-E12, full insert sequence. (Os04t058 4600-03) |
| Parent gene strand | + |
| Alternative splicing | Os04g0584600_circ_g.4 Os04g0584600_circ_g.5 Os04g0584600_circ_g.6 Os04g0584600_circ_g.7 Os04g0584600_circ_g.8 Os04g0584600_circ_g.9 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os04t0584600-01:3 Os04t0584600-02:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_014706 |
| PMCS | 0.325272265 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29533202-29532903(+) |
| Potential amino acid sequence |
MLNPRPKERLTAHEVLCHPWIRDHGVAPDRPLDPAVLSRIKQFSAMNKLKKMALRVKLLPMLSE AHIT*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |