Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0736000_circ_g.3 |
| ID in PlantcircBase | osa_circ_021692 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 30167308-30168108 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0736000 |
| Parent gene annotation |
Similar to NOT2/NOT3/NOT5 family protein, expressed. (Os03t07360 00-01);Similar to NOT2/NOT3/NOT5 family protein, expressed. (Os0 3t0736000-02) |
| Parent gene strand | - |
| Alternative splicing | Os03g0736000_circ_g.1 Os03g0736000_circ_g.2 Os03g0736000_circ_g.4 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0736000-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.21789046 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30167383-30168107(-) 30168090-30167923(-) |
| Potential amino acid sequence |
MSQQKENLSFIFQLATMLSNLHRYK*(-) MELHHKEQLHDNVPVMQAQQYPMSRSVGFNLGSNYPPNRQQHQQGANSVQNAGPQNIGLRSSAS QTSSLGSYEQLIQQYQQPQTQNPFRLQQVSSATQSYRDQSLKSIQGGQTPPDPYGLMGLLGVIR MNDADLASLALGMDLTTLGLNLNSPDNLYKTFGSPWSNEPAKGEPEFHIPACYNAEQPPPLQVA LQIMLWSCITRNNFMIMCLLCKHSNIRCQGQLALI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |