Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0736000_circ_g.3 |
ID in PlantcircBase | osa_circ_021692 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 30167308-30168108 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0736000 |
Parent gene annotation |
Similar to NOT2/NOT3/NOT5 family protein, expressed. (Os03t07360 00-01);Similar to NOT2/NOT3/NOT5 family protein, expressed. (Os0 3t0736000-02) |
Parent gene strand | - |
Alternative splicing | Os03g0736000_circ_g.1 Os03g0736000_circ_g.2 Os03g0736000_circ_g.4 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0736000-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.21789046 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
30167383-30168107(-) 30168090-30167923(-) |
Potential amino acid sequence |
MSQQKENLSFIFQLATMLSNLHRYK*(-) MELHHKEQLHDNVPVMQAQQYPMSRSVGFNLGSNYPPNRQQHQQGANSVQNAGPQNIGLRSSAS QTSSLGSYEQLIQQYQQPQTQNPFRLQQVSSATQSYRDQSLKSIQGGQTPPDPYGLMGLLGVIR MNDADLASLALGMDLTTLGLNLNSPDNLYKTFGSPWSNEPAKGEPEFHIPACYNAEQPPPLQVA LQIMLWSCITRNNFMIMCLLCKHSNIRCQGQLALI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |