Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0406300_circ_g.8 |
| ID in PlantcircBase | osa_circ_033455 |
| Alias | Os_ciR2503 |
| Organism | Oryza sativa |
| Position | chr7: 12548102-12548337 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os07g0406350 |
| Parent gene annotation |
Hypothetical protein. (Os07t0406350-00) |
| Parent gene strand | + |
| Alternative splicing | Os07g0406300_circ_g.3 Os07g0406300_circ_g.4 Os07g0406300_circ_g.5 Os07g0406300_circ_g.6 Os07g0406300_circ_g.7 |
| Support reads | 10/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0406300-01:1 Os07t0406300-02:1 Os07t0406350-00:1 Os07t0406300-01:1 Os07t0406300-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.604294162 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12548251-12548187(+) 12548123-12548243(-) |
| Potential amino acid sequence |
MISEGEPFSTFDWEALLAAFSRPASLAPCTLEDNLHSIEQKVQEISSSWQGHQMLRLQ*(+) MKIVFQSARCQGCWSGEGCQKCFPIKGGKWLTFRNHFR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |