Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0406300_circ_g.8 |
ID in PlantcircBase | osa_circ_033455 |
Alias | Os_ciR2503 |
Organism | Oryza sativa |
Position | chr7: 12548102-12548337 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | u-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os07g0406350 |
Parent gene annotation |
Hypothetical protein. (Os07t0406350-00) |
Parent gene strand | + |
Alternative splicing | Os07g0406300_circ_g.3 Os07g0406300_circ_g.4 Os07g0406300_circ_g.5 Os07g0406300_circ_g.6 Os07g0406300_circ_g.7 |
Support reads | 10/2 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os07t0406300-01:1 Os07t0406300-02:1 Os07t0406350-00:1 Os07t0406300-01:1 Os07t0406300-02:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.604294162 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
12548251-12548187(+) 12548123-12548243(-) |
Potential amino acid sequence |
MISEGEPFSTFDWEALLAAFSRPASLAPCTLEDNLHSIEQKVQEISSSWQGHQMLRLQ*(+) MKIVFQSARCQGCWSGEGCQKCFPIKGGKWLTFRNHFR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |