Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0406300_circ_g.4 |
ID in PlantcircBase | osa_circ_033451 |
Alias | Os_ciR5551 |
Organism | Oryza sativa |
Position | chr7: 12546203-12547813 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ui-circRNA |
Identification method | find_circ |
Parent gene | Os07g0406350 |
Parent gene annotation |
Hypothetical protein. (Os07t0406350-00) |
Parent gene strand | + |
Alternative splicing | Os07g0406300_circ_g.3 Os07g0406300_circ_g.5 Os07g0406300_circ_g.6 Os07g0406300_circ_g.7 Os07g0406300_circ_g.8 |
Support reads | 3 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os07t0406300-01:4 Os07t0406300-02:4 Os07t0406300-01:4 Os07t0406350-00:4 Os07t0406300-02:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.177329314 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
12547796-12547804(-) |
Potential amino acid sequence |
MEEFLKRCFYHSGQYDSEEHFMDLDKKLKQHEGSRVSNRLFYLSIPPNIFLDVVKCASKSASSG NGWTRVIVEKPFGRDSDSSSALTRGLKQYLVEDQIFRIDHYLGKELVENLSVLRFSNLVFEPLW SRQYIRNVQLIFSEDFGTEGRGGYFDRYGIIRDIMQNHLLQILALFAMETPVSLEAEDIRNEKG KL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |