Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0592400_circ_g.5 |
| ID in PlantcircBase | osa_circ_029170 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 29515291-29516014 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0592400 |
| Parent gene annotation |
UV-damaged DNA binding protein. (Os05t0592400-01);Similar to UV- damaged DNA binding protein. (Os05t0592400-02) |
| Parent gene strand | + |
| Alternative splicing | Os05g0592400_circ_g.6 Os05g0592400_circ_g.7 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0592400-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.264023999 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29516008-29515356(+) 29515855-29515938(-) |
| Potential amino acid sequence |
MSRVTGLKIEYLGETSIASSISYLDNGVVYVGSRFGDSQLVKLNLQADPNGSYVEVLERYVNLG PIVDFCVVDLDRQGQGQVVTCSGAFKDGSLRVVRNGIGINEQGNRSENRVLGRDFNCIINIISR *(+) MNHLGQLGDLVLQAVNHQIENQRRQHHYRDMILMMQLKSLPSTRFSDRLPCSLIPIPFRTTRRE PSLNAPEQVTT*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |