Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os04g0563700_circ_g.2 |
ID in PlantcircBase | osa_circ_024871 |
Alias | NA |
Organism | Oryza sativa |
Position | chr4: 28219332-28220332 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os04g0563700 |
Parent gene annotation |
Cyclin. (Os04t0563700-01) |
Parent gene strand | - |
Alternative splicing | Os04g0563700_circ_g.1 Os04g0563700_circ_g.3 Os04g0563700_circ_g.4 Os04g0563700_circ_g.5 Os04g0563700_circ_g.6 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os04t0563700-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_014651 |
PMCS | 0.18750383 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
28220150-28219415(+) 28220331-28220328(-) |
Potential amino acid sequence |
MDLNEPINQNCSHLFIYVSLTGHVIRLHTTHFRSCSPVYLLCSSQVFVHCWQRVRAHCAV*(+) MSCVQPDYMSSQGDINEKMRAILIDWLIEVHHKFELMDETLFLTVNIVDRFLEKQVVPRKKLQL VGVTAMLLACKYEEVAVPVVEDLVLISDRAYTKGQILEMEKLILNTLQFNMSVPTPYVFMRRFL KAAQSDKQLQLLSFFILELSLVEYQMLKYRPSLLAAAAVYTAQCALTRCQQWTKTCELHSRYTG EQLLK*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |