Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0484000_circ_g.16 |
| ID in PlantcircBase | osa_circ_009379 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr11: 17040607-17042093 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os11g0484000 |
| Parent gene annotation |
Class II aldolase/adducin, N-terminal family protein. (Os11t0484 000-01) |
| Parent gene strand | - |
| Alternative splicing | Os11g0484000_circ_g.1 Os11g0484000_circ_g.2 Os11g0484000_circ_g.3 Os11g0484000_circ_g.4 Os11g0484000_circ_g.5 Os11g0484000_circ_g.6 Os11g0484000_circ_g.7 Os11g0484000_circ_g.8 Os11g0484000_circ_g.9 Os11g0484000_circ_g.10 Os11g0484000_circ_g.11 Os11g0484000_circ_g.12 Os11g0484000_circ_g.13 Os11g0484000_circ_g.14 Os11g0484000_circ_g.15 Os11g0484000_circ_g.17 Os11g0484000_circ_g.18 |
| Support reads | 3 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os11t0484000-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.135056221 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17041962-17040626(+) 17042008-17040618(+) 17040643-17041981(-) 17042078-17041961(-) |
| Potential amino acid sequence |
MNRGAQSVHFGGLFGHGFDTGEESTFPSADSTYMSSATILSFCTPPQPVSQ*(+) MALIQVRRAPSHLLTAHTCPLPPSSPSAHRLSQ*(+) MSMSSLTHWLRRCAEGEDGGRGHVCAVSRWEGALLTCIKAMAKQASKMY*(-) MVAEDMYVLSADGKVLSSPVSKPWPNKPPKCTDCAPLFMKAYLMRGAGAVIHSHGMETCIATML DPGAKEFRMTHMEMIKGIKGHGYRDELVVPIIENTPYEYELTDSLAEAVCRRRGWWQRTCMCCQ QMGRCSPHLYQSHGQTSLQNVLTVLLCS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |