Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os11g0168200_circ_g.2 |
ID in PlantcircBase | osa_circ_008579 |
Alias | NA |
Organism | Oryza sativa |
Position | chr11: 3294396-3295884 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os11g0168200 |
Parent gene annotation |
Ribosomal large subunit protein L3B, Regulation of leaf morpholo gy and plant architecture (Os11t0168200-01);60S ribosomal protei n L3. (Os11t0168200-02) |
Parent gene strand | + |
Alternative splicing | Os11g0168200_circ_g.1 Os11g0168200_circ_g.3 Os11g0168200_circ_g.4 Os11g0168200_circ_g.5 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os11t0168200-02:3 Os11t0168200-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.533364046 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3294419-3294410(+) 3295198-3295883(-) |
Potential amino acid sequence |
MSHRKFEHPRHGSLGFLPRKRSSRHRGKVKSFPKDDVNKPCHLTSFVGYKAGMTHIVREVEKPG SKLHKKETCEAVTIIETPPIVVVGLVAYVKTPRGLRSLNSVWAQHLSEEVRRRFYKNWCKSKKK AFTKYALKYDSDAGKKEIQMQLEKMKKYASVVRVIVHTQVREEE*(+) MTSPCRGGGRSASSGGSRGIRASGARTSCATSSYSSSLT*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |