Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0168200_circ_g.1 |
| ID in PlantcircBase | osa_circ_008578 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr11: 3294396-3294502 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os11g0168200 |
| Parent gene annotation |
Ribosomal large subunit protein L3B, Regulation of leaf morpholo gy and plant architecture (Os11t0168200-01);60S ribosomal protei n L3. (Os11t0168200-02) |
| Parent gene strand | + |
| Alternative splicing | Os11g0168200_circ_g.2 Os11g0168200_circ_g.3 Os11g0168200_circ_g.4 Os11g0168200_circ_g.5 |
| Support reads | 26 |
| Tissues | seed, pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os11t0168200-01:1 Os11t0168200-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.331991277 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3294419-3294410(+) |
| Potential amino acid sequence |
MSHRKFEHPRHGSLGFLPRKRSSRHRGKGKGGGVRRCRTGSSSTRGTDPSASSRGSAPPATAAR VREEE*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |