Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0507900_circ_g.3 |
| ID in PlantcircBase | osa_circ_001879 |
| Alias | Os_ciR5786 |
| Organism | Oryza sativa |
| Position | chr1: 17750709-17751674 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os01g0507900 |
| Parent gene annotation |
Similar to NClpP3 (ATP-dependent Clp protease proteolytic subuni t ClpP3). (Os01t0507900-01) |
| Parent gene strand | + |
| Alternative splicing | Os01g0507900_circ_g.1 Os01g0507900_circ_g.2 Os01g0507900_circ_g.4 |
| Support reads | 2/2 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0507900-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_002100* osi_circ_009554 |
| PMCS | 0.28898241 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17751616-17750729(+) 17750794-17751653(-) |
| Potential amino acid sequence |
MVMAVQVETMGSSRRSQQLEEWEFMMP*(+) MHPWKPPVQSRQLIYQPCKISWHHKLPFLKLLRSP*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |