Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0507900_circ_g.3 |
ID in PlantcircBase | osa_circ_001879 |
Alias | Os_ciR5786 |
Organism | Oryza sativa |
Position | chr1: 17750709-17751674 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os01g0507900 |
Parent gene annotation |
Similar to NClpP3 (ATP-dependent Clp protease proteolytic subuni t ClpP3). (Os01t0507900-01) |
Parent gene strand | + |
Alternative splicing | Os01g0507900_circ_g.1 Os01g0507900_circ_g.2 Os01g0507900_circ_g.4 |
Support reads | 2/2 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0507900-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_002100* osi_circ_009554 |
PMCS | 0.28898241 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
17751616-17750729(+) 17750794-17751653(-) |
Potential amino acid sequence |
MVMAVQVETMGSSRRSQQLEEWEFMMP*(+) MHPWKPPVQSRQLIYQPCKISWHHKLPFLKLLRSP*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |