Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0279600_circ_g.3 |
ID in PlantcircBase | osa_circ_027233 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 11677291-11678994 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os05g0279600 |
Parent gene annotation |
Endonuclease/exonuclease/phosphatase domain containing protein. (Os05t0279600-01) |
Parent gene strand | + |
Alternative splicing | Os05g0279600_circ_g.1 Os05g0279600_circ_g.2 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os05t0279600-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.172015517 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
11677534-11677686(+) 11678930-11677729(+) |
Potential amino acid sequence |
MGGNCTLHCYMGNTFQLKQVEPPGFSFQIVNTNLDEDSPRARRRSALLTWQHIASLPPNLPVIY CGGFNTQKESMTGRFLLGRSREHGVVGDMRDAWPNARVRKNVSLIHTYHGFKGYEQFGISRKGS EDNTDEYCTIFYEKEKVELTEGGTFWLSESPSVPGSVSWGATAPCIATWATHFNSNK*(+) MLGQMLVSAKMFHSYIRIMDLKVMSNLGFQEKAQRITLMNIVQYSMKKKRWSLQKVVPFGCQNL LQCLEAFHGGQLHPALLHGQHISTQTSRTTWVQLPDCKYKP*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |