Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0279600_circ_g.1 |
| ID in PlantcircBase | osa_circ_027231 |
| Alias | Os_ciR4844 |
| Organism | Oryza sativa |
| Position | chr5: 11672314-11678994 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os05g0279600 |
| Parent gene annotation |
Endonuclease/exonuclease/phosphatase domain containing protein. (Os05t0279600-01) |
| Parent gene strand | + |
| Alternative splicing | Os05g0279600_circ_g.2 Os05g0279600_circ_g.3 |
| Support reads | 4/1 |
| Tissues | root/shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0279600-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_015245 |
| PMCS | 0.209915113 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
11677534-11677686(+) 11678930-11672316(+) |
| Potential amino acid sequence |
MGGNCTLHCYMGNTFQLKQVEPPGFSFQIVNTNLDEDSPRARRRSALLTWQHIASLPPNLPVIY CGGFNTQKESMTGRFLLGRSREHGVVGDMRDAWPNARVRKNVSLIHTYHGFKGLRWQLDYLQQC LPGYEQFGISRKGSEDNTDEYCTIFYEKEKVELTEGGTFWLSESPSVPGSVSWGATAPCIATWA THFNSNK*(+) MLGQMLVSAKMFHSYIRIMDLKD*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |