Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0161200_circ_g.2 |
ID in PlantcircBase | osa_circ_013210 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 3300036-3301788 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | Os02g0161200 |
Parent gene annotation |
Zinc finger, CCCH-type domain containing protein. (Os02t0161200- 01) |
Parent gene strand | + |
Alternative splicing | Os02g0161200_circ_g.3 |
Support reads | 1 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0161200-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.098165012 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3300058-3300036(+) 3301714-3300070(+) 3301788-3300085(-) |
Potential amino acid sequence |
MEALRDDKTQMEVILDEKIDEVRKISSKVNDLEVQLRREKDECHS*(+) MKCARSLAKLMILRCSLEGRKMNAIAETNTAGYGGFA*(+) MAFIFLPSKLHLKIINFARDLAHFIYLLIQNDLHLSFIVTQSLHIQPYLFQLWHSSFSLLSCTS RSLTLLEILRTSSIFSSKMTSI*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |