Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0813800_circ_g.4 |
| ID in PlantcircBase | osa_circ_017126 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 34869896-34870191 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0813800 |
| Parent gene annotation |
Similar to STYLOSA protein. (Os02t0813800-01);Non-protein coding transcript. (Os02t0813800-02) |
| Parent gene strand | - |
| Alternative splicing | Os02g0813800_circ_g.1 Os02g0813800_circ_g.2 Os02g0813800_circ_g.3 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0813800-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.444849606 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
34870157-34870133(-) 34869946-34870099(-) |
| Potential amino acid sequence |
MQMQQLQLIQHRHAQLQRTNASHPSLNGPINTLNSDGILGHSTASVLAAKMYEERLKHPQSLDS EGSQLLDASRMALLKSAATNHAGHSKSKRESTNSRCRCSSCN*(-) MLVGWLFSSQLQQIMQGTANQSERAPTADADAAVATNTTQTCSTAAN*(-) |
| Sponge-miRNAs | osa-miR530-3p |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |