Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0813800_circ_g.4 |
ID in PlantcircBase | osa_circ_017126 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 34869896-34870191 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0813800 |
Parent gene annotation |
Similar to STYLOSA protein. (Os02t0813800-01);Non-protein coding transcript. (Os02t0813800-02) |
Parent gene strand | - |
Alternative splicing | Os02g0813800_circ_g.1 Os02g0813800_circ_g.2 Os02g0813800_circ_g.3 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0813800-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.444849606 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
34870157-34870133(-) 34869946-34870099(-) |
Potential amino acid sequence |
MQMQQLQLIQHRHAQLQRTNASHPSLNGPINTLNSDGILGHSTASVLAAKMYEERLKHPQSLDS EGSQLLDASRMALLKSAATNHAGHSKSKRESTNSRCRCSSCN*(-) MLVGWLFSSQLQQIMQGTANQSERAPTADADAAVATNTTQTCSTAAN*(-) |
Sponge-miRNAs | osa-miR530-3p |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |