Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d028177_circ_g.3 |
ID in PlantcircBase | zma_circ_006433 |
Alias | Zm01circ00039, zma_circ_0000074, GRMZM2G376074_C1 |
Organism | Zea mays |
Position | chr1: 25551692-25553584 JBrowse» |
Reference genome | AGPv4.38 |
Type | u-circRNA |
Identification method | CIRI2, find_circ |
Parent gene | Zm00001d028177 |
Parent gene annotation |
Ubiquitin carboxyl-terminal hydrolase 26 |
Parent gene strand | - |
Alternative splicing | Zm00001d028177_circ_g.1 Zm00001d028177_circ_g.2 |
Support reads | NA |
Tissues | leaf, endosperm, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d028177_T013:5 Zm00001d028177_T006:5 Zm00001d028177_T010:5 Zm00001d028177_T012:5 Zm00001d028177_T023:5 Zm00001d028177_T020:5 Zm00001d028177_T024:5 Zm00001d028177_T007:5 Zm00001d028177_T016:5 Zm00001d028177_T026:4 Zm00001d028177_T021:5 Zm00001d028177_T004:5 Zm00001d028177_T018:5 Zm00001d028177_T005:5 Zm00001d028177_T014:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.090149571 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
25553522-25553578(-) |
Potential amino acid sequence |
MKRLSAAAWQKLFSKYGGGPTLSGDDFCMVCLKDGAKNAVSADVYRDRKESFKNLAEAALAGSC SDSPSYFISKAWLTHWLRRKNAGILSDADNGPTSALRCRHGYLLPEHAPGAKRVSVPESLWLFL YQTISEKVDDVVTFPSDCQPCKICSQELSDVASVEGNLRAVKLEQRYKHEKLISGKSFALRPGE KYYLVPSSWLSEWRAYITTTGKNISSLPEPQSLEAVVSSLICEKHSRLLQKPLDLVCKRGSITQ KTSNIH*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |