Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | BGIOSGA009807_circ_g.2 |
ID in PlantcircBase | osi_circ_005108 |
Alias | 3:35095859|35098023 |
Organism | Oryza sativa ssp. indica |
Position | chr3: 35095859-35098023 JBrowse» |
Reference genome | Oryza_indica.ASM465v1.42 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | BGIOSGA009807 |
Parent gene annotation | NA |
Parent gene strand | - |
Alternative splicing | BGIOSGA009807_circ_igg.1 BGIOSGA009807_circ_igg.2 BGIOSGA009807_circ_igg.3 BGIOSGA009807_circ_g.1 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | BGIOSGA009807-TA:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osa_circ_021918* osa_circ_021917 |
PMCS |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
35095958-35098013(-) 35097795-35097960(-) 35097961-35095911(+) |
Potential amino acid sequence |
MTRPRREYFGKIQSSTHAEWNSLQSQLYQMRQRQRS*(-) MELTSQGAGTYWYLPPECFDLSKTPFISSKVDVWSAGVMFYQMLFGRRPFGHDQTQERILREDT IINARRVEFPSKPAVSNEAKAKILMQSLKQHRFFQKRKRES*(-) MILASFSGRIGVALRTASRSLPLPHLIQLALKGIPLCVR*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Huang et al., 2021 |