Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0169000_circ_g.2 |
ID in PlantcircBase | osa_circ_018112 |
Alias | NA |
Organism | Oryza sativa |
Position | chr3: 3714702-3715312 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os03g0169100 |
Parent gene annotation |
Ribulose-phosphate 3-epimerase, chloroplast precursor (EC 5.1.3. 1) (Pentose-5-phosphate 3-epimerase) (PPE) (RPE) (R5P3E). (Os03t 0169100-01) |
Parent gene strand | + |
Alternative splicing | Os03g0169000_circ_g.3 Os03g0169000_circ_g.4 Os03g0169000_circ_g.5 Os03g0169000_circ_g.6 Os03g0169000_circ_g.7 Os03g0169000_circ_g.8 Os03g0169000_circ_g.9 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os03t0169000-02:1 Os03t0169000-02:1 Os03t0169100-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | zma_circ_000540 |
PMCS | 0.266561184 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3715008-3714734(+) 3714778-3715294(-) |
Potential amino acid sequence |
MDGRFVPNITIGPLVVDALRPVTDLPLDVHLMIVEPEQRVPDFIKAGADIVSVHCEQSSTIHLH RTVNQESIPSEGIIQG*(+) MEGDTMMSFFENLSTLDDALTRNAFLIDCSV*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |