Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0169000_circ_g.8 |
| ID in PlantcircBase | osa_circ_018118 |
| Alias | Os03circ04424 |
| Organism | Oryza sativa |
| Position | chr3: 3716376-3716485 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl |
| Parent gene | Os03g0169100 |
| Parent gene annotation |
Ribulose-phosphate 3-epimerase, chloroplast precursor (EC 5.1.3. 1) (Pentose-5-phosphate 3-epimerase) (PPE) (RPE) (R5P3E). (Os03t 0169100-01) |
| Parent gene strand | + |
| Alternative splicing | Os03g0169000_circ_g.2 Os03g0169000_circ_g.3 Os03g0169000_circ_g.4 Os03g0169000_circ_g.5 Os03g0169000_circ_g.6 Os03g0169000_circ_g.7 Os03g0169000_circ_g.9 |
| Support reads | 4/1 |
| Tissues | leaf/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | NA:0 Os03t0169100-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.641513636 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3716474-3716384(+) 3716397-3716384(+) |
| Potential amino acid sequence |
MCREVVDLVLIMSVNPGFGGQSFIESQVKKIAELRRLCAEKLLI*(+) MSVNPGFGGQSFIESQVKKIAELRRLCAEKLLI*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Chu et al., 2017 |