Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0266000_circ_g.6 |
ID in PlantcircBase | osa_circ_001251 |
Alias | Os_ciR6653 |
Organism | Oryza sativa |
Position | chr1: 9081266-9081570 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os01g0266000 |
Parent gene annotation |
RNA-binding protein Lupus La domain containing protein. (Os01t02 66000-01) |
Parent gene strand | + |
Alternative splicing | Os01g0266000_circ_g.3 Os01g0266000_circ_g.4 Os01g0266000_circ_g.5 |
Support reads | 2/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os01t0266000-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.212845902 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
9081367-9081276(+) |
Potential amino acid sequence |
MELKILDSLSHEGGTTEAIEKHSPLISRGSFLVTLRITPIIDLTMAVYQRAPQAIQLDISTDLL QKTTESRL*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |