Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0191700_circ_g.11 |
| ID in PlantcircBase | osa_circ_036243 |
| Alias | Os_ciR3209 |
| Organism | Oryza sativa |
| Position | chr8: 5376019-5376139 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os08g0191700 |
| Parent gene annotation |
Glyoxalase I, Abiotic stress response (Os08t0191700-01);Glyoxala se I, Splicing variant, Stress tolerance (Os08t0191700-02);Simil ar to Lactoylglutathione lyase (EC 4.4.1.5) (Methylglyoxalase) ( Aldoketomutase) (Glyoxalase I) (Glx I) (Ketone-aldehyde mutase) (S-D- lactoylglutathione methylglyoxal lyase). (Os08t0191700-03) ;Glyoxalase I, Splicing variant, Stress tolerance (Os08t0191700- 04) |
| Parent gene strand | - |
| Alternative splicing | Os08g0191700_circ_g.6 Os08g0191700_circ_g.7 Os08g0191700_circ_g.8 Os08g0191700_circ_g.9 Os08g0191700_circ_g.10 |
| Support reads | 4/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os08t0191700-04:1 Os08t0191700-02:1 Os08t0191700-01:1 Os08t0191700-03:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.125344353 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5376060-5376126(-) 5376139-5376126(-) |
| Potential amino acid sequence |
MLFTVLEIWIAPLRMASGSEAEKSPEVVLEWPKKDKKRLLHAVYRVGDLDRTIKNGKR*(-) MASGSEAEKSPEVVLEWPKKDKKRLLHAVYRVGDLDRTIKNGKR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |