Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0479400_circ_g.3 |
| ID in PlantcircBase | osa_circ_011474 |
| Alias | Os_ciR7347 |
| Organism | Oryza sativa |
| Position | chr12: 17574199-17575123 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os12g0479400 |
| Parent gene annotation |
Similar to Auxin response factor 1. (Os12t0479400-01);Similar to Auxin response factor 24. (Os12t0479400-02);Similar to Isoform 2 of Auxin response factor 24. (Os12t0479400-03) |
| Parent gene strand | - |
| Alternative splicing | Os12g0479400_circ_g.4 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os12t0479400-01:4 Os12t0479400-02:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_009725 |
| PMCS | 0.161019405 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17574984-17574282(+) 17575085-17575082(-) |
| Potential amino acid sequence |
MVPVFTACHAVARTPRCILWLDMTEDGILACCLIARRTPTRSSPFSPLLCLQQTSQVRKLKHLD EPAWFGVLEEG*(+) MRQQANIPSSVISSHSMHLGVLATAWHAVNTGTMFTVYYKPRTSPSEFVVPRDLYKESLKRNHS IGMRFKMTFEGEEAAEQRFTGTIVGVGDSDPSGWADSKWRSLKVRWDEAASVPRPDRVSPWQIE PANSPSPVNPLPAPRTKRARPNVLASSPDLSAVNKEEVRMGNYELEFGVQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |