Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0479400_circ_g.4 |
ID in PlantcircBase | osa_circ_011475 |
Alias | NA |
Organism | Oryza sativa |
Position | chr12: 17574959-17575304 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os12g0479400 |
Parent gene annotation |
Similar to Auxin response factor 1. (Os12t0479400-01);Similar to Auxin response factor 24. (Os12t0479400-02);Similar to Isoform 2 of Auxin response factor 24. (Os12t0479400-03) |
Parent gene strand | - |
Alternative splicing | Os12g0479400_circ_g.3 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os12t0479400-02:2 Os12t0479400-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.40974723 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
17575011-17575259(-) 17575085-17575120(-) |
Potential amino acid sequence |
MACSEHWNHVHCVLQAKVSHEDTFSRVVGVFL*(-) MRQQANIPSSVISSHSMHLGVLATAWHAVNTGTMFTVYYKPRSATKTPSPEWLECFCECQTPCC WRCLHISQR*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |