Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0479400_circ_g.4 |
| ID in PlantcircBase | osa_circ_011475 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 17574959-17575304 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os12g0479400 |
| Parent gene annotation |
Similar to Auxin response factor 1. (Os12t0479400-01);Similar to Auxin response factor 24. (Os12t0479400-02);Similar to Isoform 2 of Auxin response factor 24. (Os12t0479400-03) |
| Parent gene strand | - |
| Alternative splicing | Os12g0479400_circ_g.3 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os12t0479400-02:2 Os12t0479400-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.40974723 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
17575011-17575259(-) 17575085-17575120(-) |
| Potential amino acid sequence |
MACSEHWNHVHCVLQAKVSHEDTFSRVVGVFL*(-) MRQQANIPSSVISSHSMHLGVLATAWHAVNTGTMFTVYYKPRSATKTPSPEWLECFCECQTPCC WRCLHISQR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |