Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0443900_circ_g.1 |
| ID in PlantcircBase | osa_circ_028049 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 21720399-21721274 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0443900 |
| Parent gene annotation |
Similar to Basic leucine zipper protein (Liguleless2). (Os05t044 3900-01) |
| Parent gene strand | + |
| Alternative splicing | Os05g0443900_circ_g.2 Os05g0443900_circ_g.3 |
| Support reads | 3 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os05t0443900-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_015529 |
| PMCS | 0.231065221 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21720491-21720431(+) 21720488-21721233(-) |
| Potential amino acid sequence |
MIQSDAYTESAGYLAARPPTLEIFPSWPMSHLQEPYSNSQSVGSTTDSSSAQNTMSQAELVSPA SMRSDSGQEQQQQEVLMVTIDDYNYKQGLGAAIATAPSFQQHAGGLDMGVATCSCCLLW*(+) MIDTSTSTGAMDKGLLQLTKVSSSCRLQLPCLGLLHVAESLVQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |