Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0443900_circ_g.2 |
ID in PlantcircBase | osa_circ_028050 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 21720832-21721274 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, circseq_cup |
Parent gene | Os05g0443900 |
Parent gene annotation |
Similar to Basic leucine zipper protein (Liguleless2). (Os05t044 3900-01) |
Parent gene strand | + |
Alternative splicing | Os05g0443900_circ_g.1 Os05g0443900_circ_g.3 |
Support reads | 5/7 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os05t0443900-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_015530 |
PMCS | 0.315268999 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
21720889-21720888(+) |
Potential amino acid sequence |
MSHLQEPYSNSQSVGSTTDSSSAQNTMSQAELVSPASMRSDSGQEQQQQEVLMVTIDDYNYKQG LGAAIATAPSFQQHAGGLDMQQDILQLGPPHWKSSLHGQ*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2016;Chu et al., 2017 |