Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0623500_circ_g.3 |
ID in PlantcircBase | osa_circ_015560 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 24854152-24857425 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0623500 |
Parent gene annotation |
Lysyl-tRNA synthetase, class II domain containing protein. (Os02 t0623500-01);Similar to Lysyl-tRNA synthetase. (Os02t0623500-02) |
Parent gene strand | - |
Alternative splicing | Os02g0622300_circ_g.1 Os02g0622350_circ_ag.1 Os02g0622300_circ_g.2 Os02g0622350_circ_g.1 Os02g0622400_circ_g.1 Os02g0622400_circ_g.2 Os02g0623400_circ_ig.1 Os02g0623500_circ_igg.1 Os02g0623500_circ_igg.2 Os02g0623500_circ_g.1 Os02g0623500_circ_g.2 Os02g0623500_circ_g.4 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os02t0623500-01:5 Os02t0623500-02:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.212460723 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
24854224-24857397(-) 24856764-24857407(-) |
Potential amino acid sequence |
MRLGEYFGMKAFPLAIILNLPQLRGTICLREKL*(-) MIANPEVADVFRTRAKAVSEIRKTMESFGFIEVETPVLQGAAGGAEARPFITHHNSLQRDLYLR IATELHLKRMLVGGLEKVYEIGRIFRNEGISTRHNPEFTTIEGNYLFT*(-) |
Sponge-miRNAs | osa-miR2864.1 |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |