Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d016804_circ_g.5 |
ID in PlantcircBase | zma_circ_008717 |
Alias | Zm05circ00101, GRMZM2G352431_C3 |
Organism | Zea mays |
Position | chr5: 176683758-176684170 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d016804 |
Parent gene annotation |
histone methyltransferases(H3-K4 specific);histone methyltransfe rases(H3-K36 specific) |
Parent gene strand | + |
Alternative splicing | Zm00001d016804_circ_g.1 Zm00001d016804_circ_g.2 Zm00001d016804_circ_g.3 Zm00001d016804_circ_g.4 |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d016804_T002:2 Zm00001d016804_T001:2 Zm00001d016804_T003:2 Zm00001d016804_T004:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.033091203 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
176684144-176683758(+) |
Potential amino acid sequence |
MVVLGAHPKVEGTLNSLLDVDGGISKRKDATKGYLKLLVVTAAEDGSAGGTSKS*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020;Zhang et al., 2019 |