Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G12400_circ_g.2 |
ID in PlantcircBase | ath_circ_013195 |
Alias | AT2G12400_C1, AT2G12400_C1 |
Organism | Arabidpsis thaliana |
Position | chr2: 5006277-5006701 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | AT2G12400 |
Parent gene annotation |
Plasma membrane fusion protein |
Parent gene strand | - |
Alternative splicing | AT2G12400_circ_g.3 |
Support reads | NA |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT2G12400.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.212120471 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5006459-5006699(-) |
Potential amino acid sequence |
MENQDKIQNVLDIMRLALVIIAAVMLFLAFIGFL* |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Zhang et al., 2019 |