Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G12400_circ_g.3 |
ID in PlantcircBase | ath_circ_013196 |
Alias | Ath_circ_FC1189 |
Organism | Arabidpsis thaliana |
Position | chr2: 5006417-5006701 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | KNIFE, PcircRNA_finder, circRNA_finder, find_circ |
Parent gene | AT2G12400 |
Parent gene annotation |
Plasma membrane fusion protein |
Parent gene strand | - |
Alternative splicing | AT2G12400_circ_g.2 |
Support reads | 12 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT2G12400.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.474059014 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5006458-5006419(-) |
Potential amino acid sequence |
MENQDKIQNVLDIIIGCVFLYTGQGKFHASTTDTLDYVVSQANLTSENLRNVSDYLNAAKKVDV QSSILPQDVLSSIDNIQGKINSSATTLSVKTMENQDKIQNVLDIIIGCVFLYTGQGKFHASTTD TLDYVVSQANLTSENLRNVSDYLNAAKKVDVQSSILPQDVLSSIDNIQGKINSSATTLSVKTME NQDKIQNVLDIIIGCVFLYTGQGKFHASTTDTLDYVVSQANLTSENLRNVSDYLNAAKKVDVQS SILPQDVLSSIDNIQGKINSSATTLSVKTMENQDKIQNVLDI(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017;Chen et al., 2017a |