Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os07g0409100_circ_g.1 |
ID in PlantcircBase | osa_circ_033472 |
Alias | Os_ciR10868 |
Organism | Oryza sativa |
Position | chr7: 12750932-12752456 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os07g0409100 |
Parent gene annotation |
Similar to CLB1. (Os07t0409100-01) |
Parent gene strand | + |
Alternative splicing | Os07g0409100_circ_g.2 Os07g0409100_circ_g.3 Os07g0409100_circ_g.4 Os07g0409100_circ_g.5 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os07t0409100-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.215628191 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
12752377-12752453(+) |
Potential amino acid sequence |
MDIDLRWGGDPSIILAVDAVVASLPIQAATAVVKESVEPLLDDYRPPGIKSLKFSKFSLGTVSP KIEGIRIQNIQPGQIIMDIDLRWGGDPSIILAVDAVVASLPIQAATAVVKESVEPLLDDYRPPG IKSLKFSKFSLGTVSPKIEGIRIQNIQPGQIIMDIDLRWGGDPSIILAVDAVVASLPIQAATAV VKESVEPLLDDYRPPGIKSLKFSKFSLGTVSPKIEGIRIQNIQPGQIIMDIDLRWGGDPSIILA VDAVVASLPIQ(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |