Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0409100_circ_g.5 |
| ID in PlantcircBase | osa_circ_033476 |
| Alias | Os_ciR10869 |
| Organism | Oryza sativa |
| Position | chr7: 12752338-12758018 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os07g0409100 |
| Parent gene annotation |
Similar to CLB1. (Os07t0409100-01) |
| Parent gene strand | + |
| Alternative splicing | Os07g0409100_circ_g.1 Os07g0409100_circ_g.2 Os07g0409100_circ_g.3 Os07g0409100_circ_g.4 |
| Support reads | 2/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0409100-01:6 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_007134* |
| PMCS | 0.419597936 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12752377-12752373(+) |
| Potential amino acid sequence |
MDIDLRWGGDPSIILAVDAVVASLPIQLKDLQVYTIVRVVFQLSEEIPCISAVVVALLAEPEPK IQYTLKAIGGSLTAVPGLSDMIDDTVNSIVSDMLKWPHRLVVPLGVNVDTSELELKPQGRLTVT VVKATSLKNKELIGKSDPYVILYVRPMFKVKTKVIDDNLNPEWNETFPLIVEDKETQSVIFEVY DEDRLQQDKKLGVAKLAVNSLQPEATSEITLKLQQSLDSLKIKDTKDRGTLHLQVFAFKIFSQA KS*(+) |
| Sponge-miRNAs | osa-miR5152-5p |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |