Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os11g0431700_circ_g.1 |
ID in PlantcircBase | osa_circ_009241 |
Alias | NA |
Organism | Oryza sativa |
Position | chr11: 13893502-13895428 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os11g0431700 |
Parent gene annotation |
Similar to Serine carboxypeptidase. (Os11t0431700-01) |
Parent gene strand | - |
Alternative splicing | Os11g0431700_circ_g.2 Os11g0431700_circ_g.3 |
Support reads | 1 |
Tissues | shoot, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os11t0431700-01:5 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_008979 |
PMCS | 0.200873339 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
13895383-13893762(+) 13895166-13893509(+) |
Potential amino acid sequence |
MQFGFKIWALEPSCSSFTVANVKLFPYAMVNPADWPSICQALQSSTIG*(+) MTNSWHRHHILLKVEEVDVLVLHAPPSRSFCRLSHDLAWGTHKCNLGSKFGPSNLRVVALL*(+ ) |
Sponge-miRNAs | osa-miR2931 |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |