Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0431700_circ_g.1 |
| ID in PlantcircBase | osa_circ_009241 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr11: 13893502-13895428 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os11g0431700 |
| Parent gene annotation |
Similar to Serine carboxypeptidase. (Os11t0431700-01) |
| Parent gene strand | - |
| Alternative splicing | Os11g0431700_circ_g.2 Os11g0431700_circ_g.3 |
| Support reads | 1 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os11t0431700-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_008979 |
| PMCS | 0.200873339 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13895383-13893762(+) 13895166-13893509(+) |
| Potential amino acid sequence |
MQFGFKIWALEPSCSSFTVANVKLFPYAMVNPADWPSICQALQSSTIG*(+) MTNSWHRHHILLKVEEVDVLVLHAPPSRSFCRLSHDLAWGTHKCNLGSKFGPSNLRVVALL*(+ ) |
| Sponge-miRNAs | osa-miR2931 |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |