Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0431700_circ_g.3 |
| ID in PlantcircBase | osa_circ_009243 |
| Alias | Os_ciR3299 |
| Organism | Oryza sativa |
| Position | chr11: 13895115-13895428 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os11g0431700 |
| Parent gene annotation |
Similar to Serine carboxypeptidase. (Os11t0431700-01) |
| Parent gene strand | - |
| Alternative splicing | Os11g0431700_circ_g.1 Os11g0431700_circ_g.2 |
| Support reads | 3/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os11t0431700-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.127388323 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
13895383-13895172(+) 13895166-13895119(+) 13895284-13895357(-) |
| Potential amino acid sequence |
MQFGFKIWALEPSCSSFLIPRVLRVKLLFAQKYDK*(+) MTNSWHRHHILLKVEEVDVLVLHAPPSRSFCRLSHDLAWGTHKCNLGSKFGPSNLRVVAS*(+) MWCLCQLFVIFLGKQQLYTKNSRNQEATTRRFEGPNFEPKLHLCVPQAKS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |