Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os11g0431700_circ_g.3 |
ID in PlantcircBase | osa_circ_009243 |
Alias | Os_ciR3299 |
Organism | Oryza sativa |
Position | chr11: 13895115-13895428 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os11g0431700 |
Parent gene annotation |
Similar to Serine carboxypeptidase. (Os11t0431700-01) |
Parent gene strand | - |
Alternative splicing | Os11g0431700_circ_g.1 Os11g0431700_circ_g.2 |
Support reads | 3/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os11t0431700-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.127388323 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
13895383-13895172(+) 13895166-13895119(+) 13895284-13895357(-) |
Potential amino acid sequence |
MQFGFKIWALEPSCSSFLIPRVLRVKLLFAQKYDK*(+) MTNSWHRHHILLKVEEVDVLVLHAPPSRSFCRLSHDLAWGTHKCNLGSKFGPSNLRVVAS*(+) MWCLCQLFVIFLGKQQLYTKNSRNQEATTRRFEGPNFEPKLHLCVPQAKS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |